DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxc1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001007864.1 Gene:foxc1 / 493250 XenbaseID:XB-GENE-479055 Length:495 Species:Xenopus tropicalis


Alignment Length:262 Identity:68/262 - (25%)
Similarity:110/262 - (41%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAG-SGLVKPLQQ--------------K 399
            ||:.||:.||:||......|  |..|.....|....:|.| :|:..|:..              :
 Frog     1 MQARYSVSSPNSLGVVPYLS--GEQSYYRAAAAAAAAGGGYTGMAAPMSMYSHPAHEQYQAGMAR 63

  Fly   400 VKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVR 460
            ...|....|.|    ||.|||..||.:|::|:....:.::.||.|:.:.||::.:...||:||:|
 Frog    64 AYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMERFPFYRDNKQGWQNSIR 128

  Fly   461 HNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKD------------ 508
            ||||||:||.|:  |..:....||..|.::||..|..:     ...:::.:||            
 Frog   129 HNLSLNECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVVKDATKEDKDR 191

  Fly   509 ---------PAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVD 564
                     |||.:            ::.:.:.|.|.:  |.||.|:.....|::......:...
 Frog   192 LLKEHHGSQPAAAQ------------QQRQQQQGQAQA--EQDSGSQPVRIQDIKTENGTSSPPQ 242

  Fly   565 AM 566
            ||
 Frog   243 AM 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/92 (38%)
foxc1NP_001007864.1 Forkhead 79..164 CDD:365978 35/86 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 175..322 14/84 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.