DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and fd102C

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster


Alignment Length:262 Identity:68/262 - (25%)
Similarity:107/262 - (40%) Gaps:73/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LQASTTPKSIASA---ANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVS-NLVNIANN------- 383
            ||.:|..:...::   :|.|...:.:.|.||:..:..:.|.:..|.... .|.|.|.|       
  Fly     9 LQTTTADQDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCP 73

  Fly   384 -----NTSGA-------------GSGLVKPLQQKVKLPPVGSPF-----------PKPAYSYSCL 419
                 ..|||             |||.:..:.:...|..: |.|           |||.:||..|
  Fly    74 QYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTI-SLFPQTQRIFQPEEPKPQHSYIGL 137

  Fly   420 IALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKG 484
            ||:|:.:|....|.:|:||.::..::|||.:...||:||:|||||||.||.|..|.| ||   ||
  Fly   138 IAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSA-NG---KG 198

  Fly   485 CRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEE 549
            ..||                            ::|.::|...:|:.:...|...|.......:::
  Fly   199 HYWA----------------------------IHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDD 235

  Fly   550 SS 551
            :|
  Fly   236 AS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/87 (44%)
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 40/115 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445533
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.