DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxo

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster


Alignment Length:233 Identity:58/233 - (24%)
Similarity:93/233 - (39%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 GLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTS--GAGSG 391
            |.:..|..:|.......|.:.::....|.|..:.:...|...........|.|..|:|  .|...
  Fly    33 GFEPQTRARSNTWPCPRPENFVEPTDELDSTKASNQQLAPGDSQQAIQNANAAKKNSSRRNAWGN 97

  Fly   392 LVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFE-----NA 451
            |                      ||:.||..|:.::....|.:|:||.::.|:.|||:     |:
  Fly    98 L----------------------SYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNS 140

  Fly   452 PSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAM 516
            .:|||||:||||||:..|.:::...|.    |...|.:||:.  |..:.|::         |.| 
  Fly   141 SAGWKNSIRHNLSLHNRFMRVQNEGTG----KSSWWMLNPEA--KPGKSVRR---------RAA- 189

  Fly   517 VYPQHLESLE--RGEMKHGSADSDVELDSQSEIEESSD 552
                   |:|  |.|.:.|.|...||...|:.:...:|
  Fly   190 -------SMETSRYEKRRGRAKKRVEALRQAGVVGLND 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 32/92 (35%)
foxoNP_001262557.1 FH 95..175 CDD:238016 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.