DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxc2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_998857.1 Gene:foxc2 / 407875 XenbaseID:XB-GENE-481382 Length:463 Species:Xenopus tropicalis


Alignment Length:309 Identity:76/309 - (24%)
Similarity:118/309 - (38%) Gaps:86/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKV-------------K 401
            ||:.||:..|::|    ...|..:..|....|....|.|....|.|..::.             .
 Frog     1 MQARYSVADPNAL----GVVPYLSEQNYYRAAGTYGSMATPMSVYPAHEQYTPGMARSYGPYHHH 61

  Fly   402 LPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLN 466
            .|.......||.|||..||.:|::|:....:.::.||.|:...||::.....||:||:|||||||
 Frog    62 QPAAPKDLVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLN 126

  Fly   467 KCFEKIERPATNGNQRKGCRWAMNPD---------------RINKMDEEVQKWSR--KDPAAIRG 514
            :||.|:  |..:....||..|.::||               |..|.|...:|..|  ||...::|
 Frog   127 ECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSREKEDRILKDQGKVQG 189

  Fly   515 ---AMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEED 576
               ::..|:|              |..:.:.|     ||.:|           .::.:.|:...|
 Frog   190 PIPSLELPKH--------------DKKIVIKS-----ESPEL-----------PVITKVENLSPD 224

  Fly   577 G-----DDDEQIINDFDAEDERHANGNQANNLPINHPLLGQKSNDFDIE 620
            |     |....:.:......|        |::|..||    .||.|.:|
 Frog   225 GGSAMQDSPRSVASTPSVSTE--------NSIPDQHP----ASNGFSVE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/102 (35%)
foxc2NP_998857.1 Forkhead 71..156 CDD:306709 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.