DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxg1b

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_998079.2 Gene:foxg1b / 405850 ZFINID:ZDB-GENE-040426-2437 Length:341 Species:Danio rerio


Alignment Length:406 Identity:89/406 - (21%)
Similarity:138/406 - (33%) Gaps:145/406 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 QMQSNYSLGS---PSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPP------ 404
            |..:::|:.|   ||...|:..|:..|                  |...|:|...| ||      
Zfish    11 QKSTSFSIKSLLLPSKFDSADESAERG------------------GSPAPVQDLDK-PPEDAEMD 56

  Fly   405 --------------VGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGW 455
                          .|..|.||.:||:.||.:|::.|....|.::.||.|:.::|||:.....||
Zfish    57 NAQRDAEEPELQTKKGKKFDKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYREHKQGW 121

  Fly   456 KNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQ 520
            :||:||||||||||.|:  |....:..||..|.::|...:..........|:..|..||.:|   
Zfish   122 QNSIRHNLSLNKCFVKV--PRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSATSRGKLV--- 181

  Fly   521 HLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIIN 585
                     ||.|...:.:.|                                            
Zfish   182 ---------MKRGLRFAPLGL-------------------------------------------- 193

  Fly   586 DFDAEDERHANGNQANN---------LPINHPLLGQKSNDFDIEVGDLYDAIDIEDDKESVRRII 641
                     ..|.:.:|         ||::|......::.| :..|..|..:     ...|..:.
Zfish   194 ---------GLGERPSNPLYWQLSPFLPLHHSHYNGSAHGF-LNQGHTYGTL-----LPGVEPLG 243

  Fly   642 SND--QHIIELNPADLNATDGYNQQPALKRARVDINYAIGPAGELEQQYGQKVKVQQVIQPQQHP 704
            :.|  :.|:..:...:|.::||...|.             .||.|....|..|...|  |||..|
Zfish   244 NGDMSRQILGASSGSINLSNGYGVSPP-------------AAGLLSGHNGYFVPGAQ--QPQSLP 293

  Fly   705 --PTY--NRRKMPLVN 716
              |.|  :..:.||::
Zfish   294 SAPGYGISSSQSPLLS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
foxg1bNP_998079.2 FH 77..165 CDD:214627 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.