DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxm1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_957391.1 Gene:foxm1 / 394072 ZFINID:ZDB-GENE-040426-1275 Length:623 Species:Danio rerio


Alignment Length:198 Identity:61/198 - (30%)
Similarity:83/198 - (41%) Gaps:46/198 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 TSLVKSP--GGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYS-LGSPSSL 362
            |||.:|.  |..|...||.:|..:::|....|..|.|                 |.. ||..||.
Zfish   102 TSLEESKTLGCFSTELGSELGKVKKESECFPLDDSLT-----------------NIQWLGKMSSD 149

  Fly   363 SSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLP-PVGSPF-PKPAYSYSCLIALALK 425
            ...|...|        |..|.|.|          ||:.|.| ....|. .:|.|||..:|..|:.
Zfish   150 GLGSEKCP--------NKDNPNDS----------QQQSKGPEKENDPHSERPPYSYMAMIQFAIN 196

  Fly   426 NSRAGSLPVSEIYSFLCQHFPYFEN-APSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAM 489
            :.....:.:.|||:::..|||||.: |..|||||:||||||:..|  |...:.:|   |...|.:
Zfish   197 SKNNRHMTLKEIYNWIEDHFPYFRDIAKPGWKNSIRHNLSLHDMF--IRETSPDG---KISYWTI 256

  Fly   490 NPD 492
            .|:
Zfish   257 RPE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 32/83 (39%)
foxm1NP_957391.1 FH 182..256 CDD:238016 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.