DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxi2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_944598.2 Gene:foxi2 / 387256 ZFINID:ZDB-GENE-031126-2 Length:383 Species:Danio rerio


Alignment Length:281 Identity:76/281 - (27%)
Similarity:123/281 - (43%) Gaps:51/281 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 NSAAYQKLKQTSLVKSPGGISPGA--GSNMGLKREDSNKRGLQASTTPKSIASA----------A 343
            |:||...|:|  |.||....|..|  ..|..:..:.|    |.|:..|......          .
Zfish    12 NNAAVNHLQQ--LPKSAHETSDMAVYCDNFSVYHQQS----LPAAQRPAGYGLGDYATPNPYLWL 70

  Fly   344 NSPHHQMQSNYSLG--SPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGL----VKPLQQKVKL 402
            |.|.....|:|..|  |||.:..:..|..        ...:|::..||..|    :...::.:||
Zfish    71 NGPGVNSSSSYIHGNNSPSFIPPAYGSQR--------QYLSNSSGFAGPDLGWLSIASQEELLKL 127

  Fly   403 PPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNK 467
                   .:|.||||.|||:|::|:....|.:|:||.::..:||:::.:.:||:||:|||||||.
Zfish   128 -------VRPPYSYSALIAMAIQNAHEKKLTLSQIYQYVADNFPFYKKSKAGWQNSIRHNLSLND 185

  Fly   468 CFEKIERPATNGNQRKGCRWAMNPDRINKMDE---EVQKWSRKDPAAIRGAMVYPQ---HLESLE 526
            ||:|:  |....:..||..|.::|:.....|.   ..::..|.|.:....:...|:   .|..::
Zfish   186 CFKKV--PRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRRSDSSTGVSSNTKPEDDRQLAGIK 248

  Fly   527 RGEMKH----GSADSDVELDS 543
            ..:..|    .|.|:|...||
Zfish   249 PTDSPHLTGPASPDADAATDS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
foxi2NP_944598.2 Forkhead 129..215 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.