DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FoxL1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001246609.1 Gene:FoxL1 / 38471 FlyBaseID:FBgn0004895 Length:365 Species:Drosophila melanogaster


Alignment Length:356 Identity:83/356 - (23%)
Similarity:133/356 - (37%) Gaps:83/356 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAG-----SGLVKP 395
            |...|:.:..|.::...|..|.:|..|.:..:.:||         |.:...|||     .|...|
  Fly     3 PSCYANGSMLPDNEELVNSMLANPDYLRTQVSPNPL---------APSAVGGAGMEGLMCGSFSP 58

  Fly   396 ------------LQQKVKLPPV----GSPFP-KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQ 443
                        |...:...|:    .|..| ||.:||..|||:|:.::....|.:|.||.|:..
  Fly    59 AFYYQGIDSFLALHNNIWGLPISFLHNSHRPEKPPFSYIALIAMAISSAPNQRLTLSGIYKFIMD 123

  Fly   444 HFPYFENAPSGWKNSVRHNLSLNKCFEKIERPAT----NGNQRKGCRWAMNPDRINKMDEEVQKW 504
            .|||:.....||:||:|||||||.||.||.|...    |.:..||..|.::....:..::...:.
  Fly   124 KFPYYRENKQGWQNSIRHNLSLNDCFVKIPRDKNTIEDNDSAGKGSYWMLDSSASDMFEQGNYRR 188

  Fly   505 SRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDL---EEHEFEDTMVD-- 564
            .|.......|   :|...|. |.|:..:....|..|:.|.||.....|:   |...:.|.:.|  
  Fly   189 RRTRRQRHCG---HPNRYER-ESGKDSNDGNSSAAEIRSPSEPLSDFDIFCNERPNYSDRITDLH 249

  Fly   565 -----------AMLVEE--------------EDEEEDGDDDEQIINDFDAEDERHANGNQANNLP 604
                       ::...|              :|.:......:.:.:..:..:|.|:  ..|...|
  Fly   250 RQYLSVSLGFNSLFNNEARGLRPLPEIRECPDDVDASSSSSKAMQSSMELHEELHS--PSAFTPP 312

  Fly   605 INH--------PLLGQKSNDFDIEVGDLYDA 627
            :|.        |:|.:..|.    :.|:.||
  Fly   313 LNRRETSSSGAPVLAEAFNG----IKDVVDA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/91 (40%)
FoxL1NP_001246609.1 FH 91..185 CDD:214627 36/93 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445470
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.