powered by:
Protein Alignment jumu and Foxr1
DIOPT Version :9
Sequence 1: | NP_524302.1 |
Gene: | jumu / 41265 |
FlyBaseID: | FBgn0015396 |
Length: | 719 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028641.1 |
Gene: | Foxr1 / 382074 |
MGIID: | 2685961 |
Length: | 223 |
Species: | Mus musculus |
Alignment Length: | 54 |
Identity: | 23/54 - (42%) |
Similarity: | 30/54 - (55%) |
Gaps: | 4/54 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 395 PLQQKVKLP----PVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQH 444
||:...:|| |.|..:.:|...|..||||||:||....|.|.:||||..|:
Mouse 129 PLENPWRLPQAISPEGRLWSRPPLHYFHLIALALRNSPPCGLSVQQIYSFTRQN 182
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2294 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.