DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxl2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:156 Identity:51/156 - (32%)
Similarity:71/156 - (45%) Gaps:35/156 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKV 400
            |:..|....||.          |..::..:.||.|              :.|.|.|..       
  Rat     8 PEDTAGTLLSPE----------SGRAVKEAEASPP--------------SPGKGGGTA------- 41

  Fly   401 KLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSL 465
              |....|..||.|||..|||:|::.|....|.:|.||.::...||::|....||:||:||||||
  Rat    42 --PEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSL 104

  Fly   466 NKCFEKIERPATNGNQRKGCRWAMNP 491
            |:||.|:  |...|.:|||..|.::|
  Rat   105 NECFIKV--PREGGGERKGNYWTLDP 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/81 (47%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 38/81 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.