DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxc1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_599165.1 Gene:Foxc1 / 364706 RGDID:1589718 Length:553 Species:Rattus norvegicus


Alignment Length:183 Identity:53/183 - (28%)
Similarity:84/183 - (45%) Gaps:29/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPL---------------QQK 399
            ||:.||:.||:||   .....||...:....|.....|..:.:..|:               ..:
  Rat     1 MQARYSVSSPNSL---GVVPYLGGEQSYYRAAAAAAGGGYTAMPAPMSVYSHPAHAEQYPGGMAR 62

  Fly   400 VKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVR 460
            ...|....|.|    ||.|||..||.:|::|:....:.::.||.|:...||::.:...||:||:|
  Rat    63 AYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQNSIR 127

  Fly   461 HNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKD 508
            ||||||:||.|:  |..:....||..|.::||..|..:     ...:::.:||
  Rat   128 HNLSLNECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/92 (38%)
Foxc1NP_599165.1 FH 78..166 CDD:214627 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.