DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxi1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_859424.1 Gene:foxi1 / 353313 ZFINID:ZDB-GENE-030505-1 Length:377 Species:Danio rerio


Alignment Length:335 Identity:82/335 - (24%)
Similarity:131/335 - (39%) Gaps:86/335 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 HHQM----QSNYSLG--------------SPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLV 393
            |||.    .|:|.||              ||...|:...|||.|        .:...||.||.  
Zfish    55 HHQRPPAHPSSYGLGEYSSPSTNPYLWMNSPGITSTPYLSSPNG--------GSYIQSGFGSN-- 109

  Fly   394 KPLQQKVKLPPVG-----------------SPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFL 441
               |::...||.|                 ....:|.||||.|||:|::|::...|.:|:||.::
Zfish   110 ---QRQFLPPPTGFGSADLGWLSISSQQELFKMVRPPYSYSALIAMAIQNAQDKKLTLSQIYQYV 171

  Fly   442 CQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPD-----------RIN 495
            ..:||:::.:.:||:||:|||||||.||:|:.|  ...:..||..|.::|:           |..
Zfish   172 ADNFPFYKKSKAGWQNSIRHNLSLNDCFKKVAR--DEDDPGKGNYWTLDPNCEKMFDNGNFRRKR 234

  Fly   496 KMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHE--F 558
            |...:....|.|...|::  :.....|.|..:..:::....||.:       ...|...||.  |
Zfish   235 KRRADGNAMSVKSEDALK--LADTSSLMSASQPSLQNSPTSSDPK-------SSPSPSAEHSPCF 290

  Fly   559 EDTMVDAMLVEEEDEEEDGDDDEQIINDF-----------DAEDERHANGNQANNLPINH---PL 609
            .:.:.:...:...:.....|.....:.||           ...:..|.|.|:.|....:|   .|
Zfish   291 SNFIGNMNSIMSGNAVRSRDGSSAHLGDFTQHGMSGHEISPPSEPGHLNTNRLNYYSASHNNSGL 355

  Fly   610 LGQKSNDFDI 619
            :...||.|.:
Zfish   356 INSISNHFSV 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/98 (38%)
foxi1NP_859424.1 Forkhead 141..227 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.