DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and slp2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_476834.1 Gene:slp2 / 33608 FlyBaseID:FBgn0004567 Length:451 Species:Drosophila melanogaster


Alignment Length:281 Identity:73/281 - (25%)
Similarity:111/281 - (39%) Gaps:65/281 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 GLTFANSAAYQKLKQTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQM 350
            ||...|   ..|:.:|..:||...|:......:....||.     :.....||.|....:.::..
  Fly    43 GLNLTN---LMKMARTPHLKSSFSINSILPETVEHHDEDE-----EEDVEKKSPAKFPPNHNNNN 99

  Fly   351 QSNYSLGSP----------SSLSSSSAS-SPLGN-------------VSNLVNIANNNTSG---- 387
            .:..:.|||          |.|..:|.| :|:.|             |...:......|.|    
  Fly   100 LNTTNWGSPEDHEAESDPESDLDVTSMSPAPVANPNESDPDEVDEEFVEEDIECDGETTDGDAEN 164

  Fly   388 -AGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENA 451
             :..|  ||::.|     .|:  .||.|||:.||.:|::.|....|.::.||.::..:.||:.:.
  Fly   165 KSNDG--KPVKDK-----KGN--EKPPYSYNALIMMAIRQSSEKRLTLNGIYEYIMTNHPYYRDN 220

  Fly   452 PSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPD--------RINKMDEEVQKWSRKD 508
            ..||:||:||||||||||.|:  |....:..||..|.::|.        ...|:.......||..
  Fly   221 KQGWQNSIRHNLSLNKCFVKV--PRHYDDPGKGNYWMLDPSAEDVFIGGSTGKLRRRTTAASRSR 283

  Fly   509 PAAIR---------GAMVYPQ 520
            .||.:         |...|||
  Fly   284 LAAFKRSLIGPMFPGLAAYPQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/95 (37%)
slp2NP_476834.1 Forkhead 180..265 CDD:306709 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.