DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxk2a

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001184186.1 Gene:foxk2a / 324141 ZFINID:ZDB-GENE-030131-2861 Length:544 Species:Danio rerio


Alignment Length:214 Identity:64/214 - (29%)
Similarity:100/214 - (46%) Gaps:36/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 LQASTTPKSIASAANSPHHQMQSNYSLGSPS---SLSSSSASSPLGNVSNLVNIANNNTSGAGSG 391
            ::|..:|.:|:...|..|  ::|  .|.||:   |.::|..|||.|        |..::...|.|
Zfish   123 VKAQISPLTISIPENITH--LRS--PLPSPTGTISAANSCPSSPRG--------AGLSSYRMGRG 175

  Fly   392 LVKPL-----QQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPY 447
            |...|     |.::.....|...|    ||.|||:.||..|:..:....|.::.||:.:.:::||
Zfish   176 LTAELINENSQSEIDKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPY 240

  Fly   448 FENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINK-MDEEVQKWSRK---- 507
            :..|..||:||:|||||||:.|.|:.|  :.....||..|.::|....| ||:..:|...:    
Zfish   241 YRTADKGWQNSIRHNLSLNRYFIKVAR--SQEEPGKGSFWRIDPSSEGKLMDQAFRKRRPRGVPC 303

  Fly   508 -----DPAAIRGAMVYPQH 521
                 .|.:.|.|...|.|
Zfish   304 FRTPLGPLSSRSAPASPTH 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/88 (39%)
foxk2aNP_001184186.1 FHA 16..105 CDD:238017
Forkhead 204..290 CDD:278670 33/87 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.