Sequence 1: | NP_524302.1 | Gene: | jumu / 41265 | FlyBaseID: | FBgn0015396 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001184186.1 | Gene: | foxk2a / 324141 | ZFINID: | ZDB-GENE-030131-2861 | Length: | 544 | Species: | Danio rerio |
Alignment Length: | 214 | Identity: | 64/214 - (29%) |
---|---|---|---|
Similarity: | 100/214 - (46%) | Gaps: | 36/214 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 330 LQASTTPKSIASAANSPHHQMQSNYSLGSPS---SLSSSSASSPLGNVSNLVNIANNNTSGAGSG 391
Fly 392 LVKPL-----QQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPY 447
Fly 448 FENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINK-MDEEVQKWSRK---- 507
Fly 508 -----DPAAIRGAMVYPQH 521 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jumu | NP_524302.1 | Forkhead | 411..499 | CDD:278670 | 34/88 (39%) |
foxk2a | NP_001184186.1 | FHA | 16..105 | CDD:238017 | |
Forkhead | 204..290 | CDD:278670 | 33/87 (38%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |