DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxr1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006243030.1 Gene:Foxr1 / 315601 RGDID:1309739 Length:306 Species:Rattus norvegicus


Alignment Length:222 Identity:61/222 - (27%)
Similarity:92/222 - (41%) Gaps:14/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 VKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSAS 368
            ||.....|....|...||.|||..   :||..|............:.:..:...|||.....:..
  Rat    72 VKKEDSSSAPPASQSALKEEDSCS---EASEIPAQQPPPPRKQKRKQKEKHIASSPSIWEEPTEE 133

  Fly   369 SPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKL----PPVGSPFPKPAYSYSCLIALALKNSRA 429
            ....:..:..::|..:.....     |||.:.:|    .|.|..:.:|...|..||||||:||..
  Rat   134 EEAKDRDDSFSVALPSLPTRA-----PLQNRWRLRQAISPEGRLWSRPPLHYFHLIALALRNSPP 193

  Fly   430 GSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEK--IERPATNGNQRKGCRWAMNPD 492
            ..|.|.:||:|..:|||:|..||..|||:|||||.....|||  :.:......:.:.|.|.:..:
  Rat   194 CGLSVQQIYNFTREHFPFFRTAPEAWKNTVRHNLCFRDSFEKVPVSKQGEASTRPRSCLWKLTEE 258

  Fly   493 RINKMDEEVQKWSRKDPAAIRGAMVYP 519
            ...:..||.:..:.....:|:..|..|
  Rat   259 GHRRFSEEARTLASTRLQSIQQCMSQP 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/89 (38%)
Foxr1XP_006243030.1 Forkhead 175..265 CDD:278670 34/89 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.