DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxj3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:326 Identity:88/326 - (26%)
Similarity:138/326 - (42%) Gaps:69/326 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 YSLGSPSSLS---SSSASSPLGNVSNLVNI----------ANNNTSGAG----SGLVKPL----Q 397
            |....||..|   :|...|.|.::..|..:          |..|..|.|    :.|:.|.    |
  Rat     4 YGQACPSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQ 68

  Fly   398 QKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHN 462
            ::|:....|    ||.|||:.||..|:.:|....:.:||||.::|.:|||:..|.||||||:|||
  Rat    69 EEVQQHKDG----KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHN 129

  Fly   463 LSLNKCFEKIERPATNGNQRKGCRWAM--NPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL 525
            |||||||.|:  |.:..:..||..||:  ||    |.|....:..::..:..|.:..|....:||
  Rat   130 LSLNKCFLKV--PRSKDDPGKGSYWAIDTNP----KEDTLPTRPKKRARSVERASTPYSIDSDSL 188

  Fly   526 ERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDD--EQIINDFD 588
            ....:..|||...:.:                  :|:.:.:.:...|  :||.|.  ..:.|...
  Rat   189 GMECIISGSASPTLAI------------------NTVTNKVTLYNTD--QDGSDSPRSSLNNSLS 233

  Fly   589 AEDERHANGNQANNL----PI-NHP------LLGQKSNDFDIEVGD---LYDAIDIEDDKESVRR 639
            .:.....|.|...::    |: |||      |..|:...:::...|   |:...:.||...|.|.
  Rat   234 DQSLASVNLNSVGSVHSYTPVTNHPEPVSQSLTPQQQPQYNLPERDKQLLFTEYNFEDLSASFRS 298

  Fly   640 I 640
            :
  Rat   299 L 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 43/89 (48%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 76/276 (28%)
FH_FOXJ3 77..155 CDD:410826 41/83 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.