DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxd2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_233422.5 Gene:Foxd2 / 313504 RGDID:1304642 Length:494 Species:Rattus norvegicus


Alignment Length:300 Identity:84/300 - (28%)
Similarity:114/300 - (38%) Gaps:73/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 ELRKAQSSPVPNS-----LEELGKGKGSTLLNASVGATNTIKLAPGIGGLTFANSAAYQKLKQTS 302
            |:..::|||...|     ::.:|.|.|...|.|..|......:.|  .|.......|...:.:..
  Rat     9 EIMSSESSPAALSEPDADIDVVGGGSGGGELTARSGPRAPRDVLP--HGHELPPEEAEADVAEDE 71

  Fly   303 LVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSA 367
              :..||.|            |...|.|    .|:..|:||.||           .|...::..|
  Rat    72 --EESGGCS------------DCEPRAL----GPRGAAAAAGSP-----------GPGVQAARGA 107

  Fly   368 SSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVG-----SPFPKPAYSYSCLIALALKNS 427
            :.|              ..|.|.|           ||.|     ||..||.|||..||.:|:..|
  Rat   108 TGP--------------GPGPGPG-----------PPSGGAATRSPLVKPPYSYIALITMAILQS 147

  Fly   428 RAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPD 492
            ....|.:|||..|:...|||:......|:||:|||||||.||.||  |...||..||..|.::|:
  Rat   148 PKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKI--PREPGNPGKGNYWTLDPE 210

  Fly   493 RINKMDE----EVQKWSRKDPAAIRGAMVYPQHLESLERG 528
            ..:..|.    ..:|..::.|........:| |.|.|.||
  Rat   211 SADMFDNGSFLRRRKRFKRQPLPPPHPHPHP-HPELLLRG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/87 (44%)
Foxd2XP_233422.5 FH_FOXD1_D2-like 131..229 CDD:410820 40/99 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.