DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxd2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_571346.2 Gene:foxd2 / 30525 ZFINID:ZDB-GENE-980605-6 Length:369 Species:Danio rerio


Alignment Length:143 Identity:50/143 - (34%)
Similarity:68/143 - (47%) Gaps:22/143 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 NLVNIANNNTS-GAGSGLVKPLQQKVKLP-------------------PVGSPFPKPAYSYSCLI 420
            :|.|.:::|.| .||.|.:.|.|..:..|                   |..:...||.|||..||
Zfish    40 HLDNDSDDNLSQNAGEGAISPGQSSLDCPADRVGQRDDSRTGALTGDKPGKNALVKPPYSYIALI 104

  Fly   421 ALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGC 485
            .:|:..|....|.:|||..|:...|||:......|:||:|||||||.||.||  |...||..||.
Zfish   105 TMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKI--PREPGNPGKGN 167

  Fly   486 RWAMNPDRINKMD 498
            .|.::|:..:..|
Zfish   168 YWTLDPESADMFD 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 39/88 (44%)
foxd2NP_571346.2 Forkhead 95..181 CDD:278670 39/88 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.