DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxk1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001032296.2 Gene:Foxk1 / 304298 RGDID:1309643 Length:719 Species:Rattus norvegicus


Alignment Length:436 Identity:104/436 - (23%)
Similarity:168/436 - (38%) Gaps:98/436 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PLINSTSAGMFSPKKNKTASSTQGRSG--AVPSSPSAE--RDQHKSHLTFSPAQMKVSAGSMRRD 195
            |::.:.:|....|.........|...|  |:|:.|..|  .....:....:||.:..:|.|:|:.
  Rat    23 PVLCAAAAAAAFPATASPPPPAQPPPGPPALPAVPGPEPVPSTAATATATAPALVAAAAASVRQS 87

  Fly   196 ----------QVMAHIPKQISVVTGTGT---TAPATMATNSVLQRRNSSAVDAVRKDLVTELRKA 247
                      :....:.:|.||..|..:   :....|..:|.:.||:              |:.:
  Rat    88 PGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLNMGLSSFISRRH--------------LQLS 138

  Fly   248 QSSPVPNSLEELGKG----------KGSTLLNASVGATNTIKLAPGIGGLTFANSAAYQKLKQTS 302
            ...| ...|..|||.          :|:..|......|           ..|.::|.  |::.||
  Rat   139 FQEP-HFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCT-----------FRFPSTAI--KIQFTS 189

  Fly   303 LV-KSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYS-LGSPS---SL 362
            |. |.....||              .|.|....:|..|    :.|...::|..| :.||:   |:
  Rat   190 LYHKEEAPASP--------------LRPLYPQISPLKI----HIPEPDLRSLVSPIPSPTGTISV 236

  Fly   363 SSSSASSPLGNVSNLVNIANNNTSG---AGSGLVKPLQQKVKLPPVGSPFP----KPAYSYSCLI 420
            .:|..:||.|..|:......|.||.   |.....|...:: :....|...|    ||.|||:.||
  Rat   237 PNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQ-QADTSGGDSPKDESKPPYSYAQLI 300

  Fly   421 ALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGC 485
            ..|:.:::...|.:|.||:.:.:|:||:..|..||:||:|||||||:.|.|:  |.:.....||.
  Rat   301 VQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKV--PRSQEEPGKGS 363

  Fly   486 RWAMNPDRINKMDEEVQKWSRK----------DPAAIRGAMVYPQH 521
            .|.::|....|:.|:..:..|:          .|.:.|.|...|.|
  Rat   364 FWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
Foxk1NP_001032296.2 FHA <88..190 CDD:224630 21/129 (16%)
FHA 96..189 CDD:238017 20/120 (17%)
Forkhead 291..377 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.