DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxk2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:383 Identity:91/383 - (23%)
Similarity:147/383 - (38%) Gaps:106/383 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 LGKGKGSTLLNASVGATNTIK------LAPGIGGLTFANSAAYQKLKQTSLVKSPGGISPGAGSN 317
            :|:......::.|:|.::.|.      ..|..||    :|||         ...|....|.||.:
  Rat    50 IGRNSSQGSVDVSMGHSSFISRRHLEIFTPPGGG----HSAA---------APEPAQPRPDAGGD 101

  Fly   318 MGLKREDSN---------KRG---LQ---------ASTTPKSIASAANSPHHQMQ---------- 351
            ..|:....|         :||   ||         .||..|...:|.:|...:.|          
  Rat   102 FYLRCLGKNGVFVDGVFQRRGAPPLQLPRVCTFRFPSTNIKITFTALSSEKREKQEAPESPVKPV 166

  Fly   352 ----SNYSLGSPSSLSS--SSASSPLGNVSNLVNIANNNTSGAGS-----GLVKP---------L 396
                |..::..|.:::.  |...||.|.:| ..|...::..||||     |.|.|         .
  Rat   167 QPHISPLTINIPDTMAHLISPLPSPTGTIS-AANSCPSSPRGAGSSGYKMGRVIPSDLNLMADNS 230

  Fly   397 QQKVKLPPVGSPFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKN 457
            |.:.:....|...|    ||.|||:.||..|:..:....|.::.||:.:.:::||:..|..||:|
  Rat   231 QPENEKEASGGDSPKDDSKPPYSYAQLIVQAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQN 295

  Fly   458 SVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRK----------DPAAI 512
            |:|||||||:.|.|:  |.:.....||..|.::|...:|:.|:..:..|.          .|.:.
  Rat   296 SIRHNLSLNRYFIKV--PRSQEEPGKGSFWRIDPASESKLVEQAFRKRRPRGVPCFRTPLGPLSS 358

  Fly   513 RGAMVYPQHL-------------ESLERG------EMKHGSADSDVELDSQSEIEESS 551
            |.|...|.|.             |||.|.      |.:.|::...:.:..::...:|:
  Rat   359 RSAPASPNHAGVLSAHSSGAQTPESLSREGSPAPLEPEPGASQPKLAVIQEARFAQSA 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 33/87 (38%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017 23/107 (21%)
Forkhead 249..335 CDD:278670 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.