DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxn4

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_571174.1 Gene:foxn4 / 30315 ZFINID:ZDB-GENE-990415-277 Length:550 Species:Danio rerio


Alignment Length:382 Identity:138/382 - (36%)
Similarity:185/382 - (48%) Gaps:71/382 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 RSGAVPSSPSAERDQ-HKSHLTFSPAQMKVSAGSMRRDQVMAHIPKQISVVTGTGTTAPATMATN 222
            |:|.....|:.|... ..|.:.::|.|               |..||..:.:|. ||..:.:..|
Zfish    19 RAGQQVPRPTLELSSVWLSKIFYNPEQ---------------HHNKQKMIESGI-TTRMSGIHEN 67

  Fly   223 SVLQRRNSSAVDAVRKDLVTELRKAQSSPVPNSLEELGKGKGSTLLNASVGATNTIKLAPGIGGL 287
            .. |..::||.|   ..|:|.........:|..|:.|     |.|.:..|.....|    |.|..
Zfish    68 PG-QSHHTSAQD---YRLLTTDPSQLKDELPGDLQSL-----SWLTSVDVPRLQQI----GGGRP 119

  Fly   288 TFANSAAYQKLKQTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQS 352
            .|.:||....|::.:...:...::.||||.:.|:.|      :|.|  |.:|.|         ..
Zfish   120 DFTSSAQSSLLERQTAQLNSMTVAGGAGSAIHLQSE------MQHS--PLAINS---------MP 167

  Fly   353 NYSLGSPSSLS--------------SSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLP 403
            .:|.|.|.:.|              ::...||.|...| .|..|.......:...:.||.|.   
Zfish   168 QFSPGFPCAASVYQTAPQQVLTFTQANQQCSPGGLYGN-YNSQNLFPQPRITAHSQDLQPKC--- 228

  Fly   404 PVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKC 468
                 ||||.||||||||:|||||:.|||||||||||:.:|||||:.||.|||||||||||||||
Zfish   229 -----FPKPIYSYSCLIAMALKNSKTGSLPVSEIYSFMKEHFPYFKTAPDGWKNSVRHNLSLNKC 288

  Fly   469 FEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL 525
            |||:|. ..:|:.||||.||:||.:|:||:||:|||.|||..|||.:|..|..|:.|
Zfish   289 FEKVEN-KMSGSSRKGCLWALNPAKIDKMEEEMQKWKRKDLPAIRRSMANPDELDKL 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 64/87 (74%)
foxn4NP_571174.1 Forkhead 231..318 CDD:278670 64/87 (74%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 402..437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 142 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007398
OrthoInspector 1 1.000 - - otm25174
orthoMCL 1 0.900 - - OOG6_107576
Panther 1 1.100 - - LDO PTHR13962
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2111
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.