DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxh1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:289 Identity:68/289 - (23%)
Similarity:98/289 - (33%) Gaps:116/289 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 PKSIASAAN-SPHHQ------------MQSNYSLG---SPSSLSSSSASSPLGNVSNLVNIANNN 384
            |...||.:: ||.||            |.|.:.|.   ||::||.....:          :|...
  Rat     3 PSPTASFSHPSPFHQNDKERAWPPCPSMASGWDLASTYSPTTLSPQLVQA----------LAQGY 57

  Fly   385 TSGAGSGLVKPLQQKVKLPPVG---SPFP-----------KPAYSYSCLIALALKNSRAGSLPVS 435
            ....|     ||......||..   |..|           ||.|:|..:|||.::..:|      
  Rat    58 IPCMG-----PLDNSQLRPPEAESLSKTPKRRKKRYLRHDKPPYTYLAMIALIIRQVQA------ 111

  Fly   436 EIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIER-PATNGNQRKGCRWAMNPDRINKMDE 499
                    .||:|.:...|||:|:|||||.|:||.|:.: ||.  .|.||..||::...|.....
  Rat   112 --------VFPFFRDDYEGWKDSIRHNLSSNRCFRKVPKDPAK--PQAKGNFWAVDVSLIPAEAL 166

  Fly   500 EVQ------KWSRK----------DPAAIRG---------------------------AMVYPQH 521
            .:|      :|..:          .|..:.|                           |..:|||
  Rat   167 RLQNTALCRRWQNRGTHRAFAKDLSPYVLHGQPYRPPSPPPPSREDFSIKSLLGDPGKASTWPQH 231

  Fly   522 -----------LESLERGEMKHGSADSDV 539
                       ..:|.:||...|:..|:|
  Rat   232 PRLAGQSTPAQASTLSKGEEGIGAGPSNV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 32/88 (36%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.