DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxd3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:239 Identity:69/239 - (28%)
Similarity:93/239 - (38%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LTFANSAAYQKLK-QTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSI----------A 340
            :|.:.|.:...:. ||.|......|......:.||:.:||: .|..:...|..:          |
  Rat     1 MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSD-AGCDSPAGPPDLRLDEADEGLPA 64

  Fly   341 SAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVN----------IANNNTSGAGSGLV-- 393
            ||    ||......:|..|     |.|:.| ||.:....          :......|||.|..  
  Rat    65 SA----HHGQSQPQALALP-----SEATGP-GNDTGAPEADGCKGGEDAVTGGGGPGAGGGATGG 119

  Fly   394 ----KPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSG 454
                ||....|          ||.|||..||.:|:..|....|.:|.|..|:...|||:......
  Rat   120 LTPNKPKNSLV----------KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPA 174

  Fly   455 WKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD 498
            |:||:|||||||.||.||  |...||..||..|.::|...:..|
  Rat   175 WQNSIRHNLSLNDCFVKI--PREPGNPGKGNYWTLDPQSEDMFD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/88 (43%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 39/99 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.