DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxn1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_038941420.1 Gene:Foxn1 / 287469 RGDID:3970 Length:675 Species:Rattus norvegicus


Alignment Length:439 Identity:138/439 - (31%)
Similarity:183/439 - (41%) Gaps:132/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 SSPSAERDQHKSHLTFSPAQMKVSAGSMRRDQVMAHIPKQISVVTGTGTTAPATMATNSVLQRRN 229
            ||||.......||..||    :.|.||.:......|:               .|::..|..:..|
  Rat    27 SSPSLRDSCGFSHSLFS----QYSIGSWQGPWSNLHL---------------QTLSILSAQKHAN 72

  Fly   230 SSAVDAV------RKDLVTELRKAQSSPVPNSLEE---LGKGKGSTLLNASVGATNTIKLAPGIG 285
            .|....|      |...:.....:.:||.|..::.   .|.|.||..|:.|       ...||.|
  Rat    73 FSCSSFVPDGPPERAPSLPPHSPSVASPGPEQIQSHCTAGPGPGSFRLSPS-------DKYPGFG 130

  Fly   286 GLTFANSAAYQKLKQTSLVKSPGGISPG---AGSNM------GLKRED----------------S 325
                             ..:.|.| |||   .|::|      |...||                .
  Rat   131 -----------------FEEGPAG-SPGRFLRGNHMPFHPYKGHFHEDIFSEAQTAMALDGHSFK 177

  Fly   326 NKRGLQA-STTPKSIASAA-------------NSPHHQMQSNYSL-GS-----PSSLSSSSA--- 367
            .:..|:| ...|..:..|.             ..|:...:.|..| ||     |.:|.:...   
  Rat   178 TQGALEAFEEIPVDVGDAEAFLPSFPAEAWCNGLPYPSQEHNQVLQGSEVKVKPQALDNGPGMYC 242

  Fly   368 -SSPLGNV-SNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSP-------------------FPK 411
             ..||.:| .:.....:..:.|.||         ..:|.:||.                   |||
  Rat   243 YQPPLQHVYCSSQPTFHQYSPGGGS---------YPVPYLGSTHYPYQRIAPQANADGHQPLFPK 298

  Fly   412 PAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPA 476
            |.||||.||.:|||||:.|||||||||:|:.:|||||:.||.||||||||||||||||||:|. .
  Rat   299 PIYSYSILIFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVEN-K 362

  Fly   477 TNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL 525
            :..:.||||.||:||.:|:||.||:|||.||||.|:|.:|..|:.|:||
  Rat   363 SGSSSRKGCLWALNPSKIDKMQEELQKWKRKDPIAVRKSMAKPEELDSL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 60/87 (69%)
Foxn1XP_038941420.1 FH_FOXN1 297..393 CDD:410830 66/96 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353642
Domainoid 1 1.000 135 1.000 Domainoid score I4843
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45714
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.