DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001099246.1 Gene:Foxi1 / 287185 RGDID:1307421 Length:372 Species:Rattus norvegicus


Alignment Length:224 Identity:60/224 - (26%)
Similarity:97/224 - (43%) Gaps:42/224 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            :|.||||.|||:|:..:....|.:|:||.::..:||::..:.:||:||:|||||||.||:|:  |
  Rat   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKV--P 179

  Fly   476 ATNGNQRKGCRWAMNPDRINKMDEEVQKWSRK---DPAAIRGAMVYPQHLESLERGEMKHGSADS 537
            ....:..||..|.::|:.....|....:..||   |.::..|::                .|..:
  Rat   180 RDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDASSSTGSL----------------ASEKT 228

  Fly   538 DVELDSQSEIEESSDLEEHEFEDT-MVDAMLVEEEDEEEDGDDDEQIINDFDAEDERHANGNQAN 601
            :..|.|.|    ....|..|..|| ..|......|............:|:|.:....:.||..  
  Rat   229 ENRLLSSS----PKPTEPQEVLDTASPDTTSSSPEKRSSPAPSGTPCLNNFLSTMTAYVNGTN-- 287

  Fly   602 NLPIN----------HPL--LGQKSNDFD 618
              ||:          .|:  :||.|.:|:
  Rat   288 --PISRSAATPGLSPEPVDKMGQNSLNFN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/87 (39%)
Foxi1NP_001099246.1 FH 117..205 CDD:214627 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.