DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXD4L3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_954586.4 Gene:FOXD4L3 / 286380 HGNCID:18523 Length:417 Species:Homo sapiens


Alignment Length:112 Identity:41/112 - (36%)
Similarity:57/112 - (50%) Gaps:11/112 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 GSGLVKPLQ--QKVKLPPVGSPF-------PKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQH 444
            |.|...|.:  .|.:.||..:..       .||.|||..||.:|:..:....|.:|.|.:|:...
Human    77 GGGPSDPSEFGTKFRAPPRSAAASEDARQPAKPPYSYIALITMAILQNPHKRLTLSGICAFISGR 141

  Fly   445 FPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNP 491
            |||:......|:||:|||||||.||.||  |...|:..||..|:::|
Human   142 FPYYRRKFPAWQNSIRHNLSLNDCFVKI--PREPGHPGKGNYWSLDP 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/81 (43%)
FOXD4L3NP_954586.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 6/27 (22%)
Forkhead 108..194 CDD:278670 35/81 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.