DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXD3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_036315.1 Gene:FOXD3 / 27022 HGNCID:3804 Length:478 Species:Homo sapiens


Alignment Length:171 Identity:59/171 - (34%)
Similarity:74/171 - (43%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   331 QASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGL--- 392
            |..|.||..|.|...|      ...:|:|      .|....|.|......|:....|||||.   
Human    77 QPLTLPKEAAGAGAGP------GGDVGAP------EADGCKGGVGGEEGGASGGGPGAGSGSAGG 129

  Fly   393 VKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKN 457
            :.|.:.|..|       .||.|||..||.:|:..|....|.:|.|..|:...|||:......|:|
Human   130 LAPSKPKNSL-------VKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQN 187

  Fly   458 SVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD 498
            |:|||||||.||.||  |...||..||..|.::|...:..|
Human   188 SIRHNLSLNDCFVKI--PREPGNPGKGNYWTLDPQSEDMFD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/88 (43%)
FOXD3NP_036315.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136 19/70 (27%)
Forkhead 141..227 CDD:278670 38/88 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.