DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_899016.2 Gene:Foxi2 / 270004 MGIID:3028075 Length:311 Species:Mus musculus


Alignment Length:187 Identity:59/187 - (31%)
Similarity:97/187 - (51%) Gaps:30/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IASAANSPHHQMQSNYSLG---SPSSLSSSSA--SSPLGNVSNLVNIANNNTSGAGSGLVKPLQQ 398
            :.|||.||     :.|:.|   :||..:::.|  .|.||        |:...:||....:....|
Mouse    40 VNSAALSP-----APYATGPGPAPSYAAATLAVPGSLLG--------ASGGLAGADLAWLSLSGQ 91

  Fly   399 KVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNL 463
            :..|..|     :|.||||.|||:|::::....|.:|:||.::..:||:::.:.:||:||:||||
Mouse    92 QELLRLV-----RPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNL 151

  Fly   464 SLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRK-----DPAAIRGA 515
            |||.||:|:  |....:..||..|.::|:.....|....:..|:     ..||:.||
Mouse   152 SLNDCFKKV--PRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRGETSEAAVPGA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/87 (39%)
Foxi2NP_899016.2 Forkhead 99..184 CDD:333958 34/86 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..237 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 263..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.