DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxn1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_997738.1 Gene:foxn1 / 266748 ZFINID:ZDB-GENE-021008-1 Length:565 Species:Danio rerio


Alignment Length:256 Identity:107/256 - (41%)
Similarity:140/256 - (54%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 SPGGISPG----AGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGS--PSSLSS 364
            |.|.||.|    .....||.||.::..||:..::..::.:       .:::...:|:  |.|...
Zfish   103 SEGAISEGQPFSCVRRAGLAREIASADGLEEQSSWTTLGT-------DVETTSIMGTRRPYSEPQ 160

  Fly   365 SSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVG--------------------SP- 408
            .|:..|.|..:     .|:.:..|    :.|||.:. .|..|                    || 
Zfish   161 ESSEEPPGYTT-----VNHQSYSA----ISPLQHQY-YPSRGIDTVSHYYNQSLSTQTSQDSSPQ 215

  Fly   409 --FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEK 471
              :|||.||||.||.|||:||:.|||||||||||:.:|||||:.||.||||||||||||||||||
Zfish   216 PLYPKPVYSYSILIFLALRNSKTGSLPVSEIYSFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEK 280

  Fly   472 IERPATNGN-QRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL--ERGE 529
            :|.  .||| .||||.||:||.::.||.||:.||.||||..:|.:|..|:.||.|  ||.|
Zfish   281 VEN--KNGNSSRKGCLWALNPAKVEKMQEELHKWRRKDPLTVRRSMARPEELERLLGERPE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 63/88 (72%)
foxn1NP_997738.1 Forkhead 220..307 CDD:278670 63/88 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595787
Domainoid 1 1.000 142 1.000 Domainoid score I4631
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25174
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2111
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.