DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:309 Identity:78/309 - (25%)
Similarity:127/309 - (41%) Gaps:87/309 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 TELRKAQSSPVPNSLEELGK--------GKGSTLLNASV--GATNTIKLAPGIGGLTFANSAAYQ 296
            ||......:|.|...:..|:        |.||    .||  |.|..|...|..|.   |:..:.:
  Rat     5 TEPTAPAPAPAPAPAQAGGELDMAGFCDGLGS----CSVPHGLTRAIAHPPSYGR---ADLGSGR 62

  Fly   297 KLKQTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSS 361
            :|...|...||...:||.|                    |....:||                :.
  Rat    63 RLWVNSTALSPAPYTPGPG--------------------PAPTYAAA----------------AL 91

  Fly   362 LSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKN 426
            ..|.|..||.|.::. .::|..:.||.        |:.::|       .:|.||||.|||:|:::
  Rat    92 AVSGSLLSPSGGLAG-ADLAWLSLSGQ--------QELLRL-------VRPPYSYSALIAMAIQS 140

  Fly   427 SRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNP 491
            :....|.:|:||.::..:||:::.:.:||:||:|||||||.||:|:  |....:..||..|.::|
  Rat   141 APLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCFKKV--PRDENDPGKGNYWTLDP 203

  Fly   492 D----------------RINKMDEEVQKWSRKDPAAIRGAMVYPQHLES 524
            :                |....:..|...||.:.||:..:.:..|.|::
  Rat   204 NCEKMFDNGNFRRKRRRRGETSEAAVPGASRPERAALEPSGLVSQDLQT 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/103 (34%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.