DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:277 Identity:75/277 - (27%)
Similarity:117/277 - (42%) Gaps:59/277 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 PGIGGLTFANSAAYQKLKQTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSP 346
            ||:||.  |::|:|     ......|.|.:||.              .||....|.:.|.|    
Mouse    50 PGVGGP--ASAASY-----LGAPPPPPGAAPGP--------------FLQPPAAPGTFAGA---- 89

  Fly   347 HHQMQSNY---SLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSP 408
                |..:   |..:|:|.:.|:|...||.:|          ..:...|:|.:            
Mouse    90 ----QRGFAQPSASAPASPAGSAAPGELGWLS----------MASREDLMKMV------------ 128

  Fly   409 FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIE 473
              :|.||||.|||:|::::....|.:|.||.|:..:||:::.:.:||:||:|||||||.||:|: 
Mouse   129 --RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDCFKKV- 190

  Fly   474 RPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSD 538
             |....:..||..|.::|:.....|....:..|:..|.....:..|......| |:.........
Mouse   191 -PRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRAEASSNLTVPSGTSKSE-GQSSRLRVSGK 253

  Fly   539 VELDSQSEIEESSDLEE 555
            :|.||.|.|...|...|
Mouse   254 LEGDSPSSILRPSQSPE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/87 (40%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.