DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXS1

DIOPT Version :10

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:157 Identity:48/157 - (30%)
Similarity:72/157 - (45%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 QKVKLPPVGSPF---PKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSV 459
            |:..||..|:|.   .||.|||..|||:|:::|......:|.||.::...|.::.:...||:||:
Human     2 QQQPLPGPGAPTTEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSI 66

  Fly   460 RHNLSLNKCFEKIERPATNGNQRKGCRWAMNPD------------RINKMDEEVQKWSRKDPAAI 512
            |||||||:||.|:  |..:....||..|.::||            |..:...:......:.||..
Human    67 RHNLSLNECFVKV--PRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKA 129

  Fly   513 RGAMVYPQHLESLERGEMKHGSADSDV 539
            |             ||.::..|.|..|
Human   130 R-------------RGPLRATSQDPGV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 COG5025 <254..>523 CDD:227358 43/139 (31%)
FH_FOXN1-like 411..491 CDD:410804 32/79 (41%)
FOXS1NP_004109.1 FH_FOXS1 17..116 CDD:410811 35/100 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 8/46 (17%)
PRK12323 <116..313 CDD:481241 8/41 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.