DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXD2

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_004465.3 Gene:FOXD2 / 2306 HGNCID:3803 Length:495 Species:Homo sapiens


Alignment Length:305 Identity:85/305 - (27%)
Similarity:116/305 - (38%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 ELRKAQSSPVPNS-----LEELGKGKGSTLLNASVGATNTIKLAPGIGGLTFANSAAYQKLKQTS 302
            |:..::|||...|     ::.:|.|.|...|.|..|..     ||                 :..
Human     9 EIMSSESSPAALSEADADIDVVGGGSGGGELPARSGPR-----AP-----------------RDV 51

  Fly   303 LVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIAS-----AANSPHHQMQSNYSLGSPSSL 362
            |   |.|..|.|........||..:.|..:...|:::||     ||.||           .|.:.
Human    52 L---PHGHEPPAEEAEADLAEDEEESGGCSDGEPRALASRGAAAAAGSP-----------GPGAA 102

  Fly   363 SSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVG-----SPFPKPAYSYSCLIAL 422
            ::..|:.|                  |.|           ||.|     ||..||.|||..||.:
Human   103 AARGAAGP------------------GPG-----------PPSGGAATRSPLVKPPYSYIALITM 138

  Fly   423 ALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRW 487
            |:..|....|.:|||..|:...|||:......|:||:|||||||.||.||  |...||..||..|
Human   139 AILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKI--PREPGNPGKGNYW 201

  Fly   488 AMNPDRINKMDE----EVQKWSRKDPAAIRGAMVYPQHLESLERG 528
            .::|:..:..|.    ..:|..::.|........:| |.|.|.||
Human   202 TLDPESADMFDNGSFLRRRKRFKRQPLPPPHPHPHP-HPELLLRG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/87 (44%)
FOXD2NP_004465.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..122 35/172 (20%)
Forkhead 127..213 CDD:278670 38/87 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..347
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..444
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.