DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXL1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:133 Identity:44/133 - (33%)
Similarity:70/133 - (52%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            ||.|||..|||:|::::....:.::.||.|:...||::.:...||:||:|||||||.||.|:  |
Human    49 KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKV--P 111

  Fly   476 ATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVE 540
            ...|...||..|.::|..::..:....:..::.|....||   |:  ....|.|....||::..|
Human   112 REKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPGPGA---PE--AKRPRAETHQRSAEAQPE 171

  Fly   541 LDS 543
            ..|
Human   172 AGS 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/87 (39%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 34/89 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.