DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXI1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:261 Identity:70/261 - (26%)
Similarity:109/261 - (41%) Gaps:63/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 GLVKPLQQKVKLPPV----GS-----PFP---------KPAYSYSCLIALALKNSRAGSLPVSEI 437
            |:.:||     ||.|    ||     |.|         :|.||||.|||:|:..:....|.:|:|
Human    90 GVQRPL-----LPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQI 149

  Fly   438 YSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMDEE-- 500
            |.::..:||::..:.:||:||:|||||||.||:|:  |....:..||..|.::|: ..||.:.  
Human   150 YQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKV--PRDEDDPGKGNYWTLDPN-CEKMFDNGN 211

  Fly   501 -VQKWSRKDPAAIRGAMVYPQHLESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVD 564
             .:|..||...:...|.:      :||:.|       |.:.:||....|....|     :.....
Human   212 FRRKRKRKSDVSSSTASL------ALEKTE-------SSLPVDSPKTTEPQDIL-----DGASPG 258

  Fly   565 AMLVEEEDEEEDGDDDEQIINDFDAEDERHANGNQANNLPINHPLL------------GQKSNDF 617
            ......|............:|.|.:....:.:|..    |.:|||:            ||.|..|
Human   259 GTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGS----PTSHPLVTPGLSPEPSDKTGQNSLTF 319

  Fly   618 D 618
            :
Human   320 N 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/87 (41%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
FH 123..211 CDD:214627 36/90 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.