DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxe1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_620264.1 Gene:Foxe1 / 192274 RGDID:621723 Length:370 Species:Rattus norvegicus


Alignment Length:201 Identity:55/201 - (27%)
Similarity:90/201 - (44%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 ASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSG---LVKPLQQKVK 401
            |.:|..|..|.::..::......:::.|..|.            ..:|.|:|   ..:|||:   
  Rat     3 AESAPPPPPQPEALAAVKEERGEAAAGAGVPA------------EVAGRGAGGRRRKRPLQR--- 52

  Fly   402 LPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLN 466
                    .||.|||..|||:|:.::....|.:..||.|:.:.||::.:.|..|:||:||||:||
  Rat    53 --------GKPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSIRHNLTLN 109

  Fly   467 KCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKD-------------PAAIR 513
            .||.||.|.|  |...||..||::|:..:..:     ...:::.|.|             .||..
  Rat   110 DCFLKIPREA--GRPGKGNYWALDPNAEDMFESGSFLRRRKRFKRSDLSTYPAYMHDAAAAAAAA 172

  Fly   514 GAMVYP 519
            .|.::|
  Rat   173 AAAIFP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/92 (40%)
Foxe1NP_620264.1 FH_FOXE 54..142 CDD:410793 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.