DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxc1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_032618.2 Gene:Foxc1 / 17300 MGIID:1347466 Length:553 Species:Mus musculus


Alignment Length:186 Identity:58/186 - (31%)
Similarity:86/186 - (46%) Gaps:35/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSG-LVKPLQQKVKLPPV------GS 407
            ||:.||:.||:||   .....||...:....|   .:.||.| ...|....|...|.      ||
Mouse     1 MQARYSVSSPNSL---GVVPYLGGEQSYYRAA---AAAAGGGYTAMPAPMSVYSHPAHAEQYPGS 59

  Fly   408 -----------PFP----KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKN 457
                       |.|    ||.|||..||.:|::|:....:.::.||.|:...||::.:...||:|
Mouse    60 MARAYGPYTPQPQPKDMVKPPYSYIALITMAIQNAPDKKITLNGIYQFIMDRFPFYRDNKQGWQN 124

  Fly   458 SVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKD 508
            |:|||||||:||.|:  |..:....||..|.::||..|..:     ...:::.:||
Mouse   125 SIRHNLSLNECFVKV--PRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 35/92 (38%)
Foxc1NP_032618.2 Required for transcriptional activation. /evidence=ECO:0000250|UniProtKB:Q12948 1..51 16/55 (29%)
FH 78..166 CDD:214627 35/89 (39%)
Nuclear localization signal 1 (NLS 1). /evidence=ECO:0000250|UniProtKB:Q12948 78..93 8/14 (57%)
Nuclear localization signal 2 (NLS 2). /evidence=ECO:0000250|UniProtKB:Q12948 168..176 0/7 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..326 2/6 (33%)
Required for transcriptional inhibition. /evidence=ECO:0000250|UniProtKB:Q12948 217..366
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..393
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 420..466
Required for transcriptional activation. /evidence=ECO:0000250|UniProtKB:Q12948 466..553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.