DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and let-381

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:152 Identity:50/152 - (32%)
Similarity:74/152 - (48%) Gaps:28/152 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            ||.:||..|||:|:.........::||||:|.::|.:|....:||:||:|||||||:||.|:  |
 Worm    72 KPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNECFVKL--P 134

  Fly   476 ATNGNQ---RKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESLER---------G 528
            ...|..   |||.:|.:: |....|.||            .|....|:..::.:|         .
 Worm   135 KDTGESYRGRKGHKWTIS-DSCEFMLEE------------NGFRRRPRGYKARKRTHFPGVTASN 186

  Fly   529 EMKHGSADSDVELDSQSEIEES 550
            ||..|.|..|.. .|.:|:.:|
 Worm   187 EMGIGGATFDYP-SSTTELTDS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/90 (41%)
let-381NP_491826.1 Forkhead 71..160 CDD:365978 37/90 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.