DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxd1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_599164.2 Gene:Foxd1 / 171299 RGDID:621712 Length:455 Species:Rattus norvegicus


Alignment Length:179 Identity:58/179 - (32%)
Similarity:76/179 - (42%) Gaps:27/179 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 LKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNN 384
            |:.||.::..|.||....|.|....:|..      ..||.....:.:.....|.|.     |...
  Rat    64 LEEEDDDEDLLLASRPAASPAPPGPAPAP------GAGSGGCSGAGAGGGAGGGVG-----AGAG 117

  Fly   385 TSGAGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFE 449
            |.|.||.              .:|..||.|||..||.:|:..|....|.:|||..|:...|||:.
  Rat   118 TGGGGSS--------------KNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYR 168

  Fly   450 NAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD 498
            .....|:||:|||||||.||.||  |...||..||..|.::|:..:..|
  Rat   169 EKFPAWQNSIRHNLSLNDCFVKI--PREPGNPGKGNYWTLDPESADMFD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 39/88 (44%)
Foxd1NP_599164.2 FH_FOXD1_D2-like 130..228 CDD:410820 39/88 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.