DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxd1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_032268.2 Gene:Foxd1 / 15229 MGIID:1347463 Length:456 Species:Mus musculus


Alignment Length:209 Identity:61/209 - (29%)
Similarity:81/209 - (38%) Gaps:50/209 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   308 GGISPGAGSNM------------------GLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNY 354
            ||...|.||.:                  .|:.||.:.. |.||....|.|....:|        
Mouse    39 GGGRGGGGSRLPSSAQRRRRSYAGEDDLEDLEEEDDDDL-LLASRPAASPAPPGPAP-------- 94

  Fly   355 SLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVGSPFPKPAYSYSCL 419
               :|.:.|...:.:..|.     .......:|.|.|...||             .||.|||..|
Mouse    95 ---APGTGSGGCSGAGAGG-----GAGGGTGAGTGGGAKNPL-------------VKPPYSYIAL 138

  Fly   420 IALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKG 484
            |.:|:..|....|.:|||..|:...|||:......|:||:|||||||.||.||  |...||..||
Mouse   139 ITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKI--PREPGNPGKG 201

  Fly   485 CRWAMNPDRINKMD 498
            ..|.::|:..:..|
Mouse   202 NYWTLDPESADMFD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 39/88 (44%)
Foxd1NP_032268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 16/76 (21%)
Forkhead 130..216 CDD:278670 39/88 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..322
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.