DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxg1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001153584.1 Gene:Foxg1 / 15228 MGIID:1347464 Length:481 Species:Mus musculus


Alignment Length:191 Identity:54/191 - (28%)
Similarity:87/191 - (45%) Gaps:40/191 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 GSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLPPVG-------------SP 408
            |.|:.|      :|:|        .:....|||:|    .::|......|             ..
Mouse   124 GGPAEL------APVG--------PDEKEKGAGAG----GEEKKGAGEGGKDGEGGKEGDKKNGK 170

  Fly   409 FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIE 473
            :.||.:||:.||.:|::.|....|.::.||.|:.::|||:.....||:||:||||||||||.|: 
Mouse   171 YEKPPFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKV- 234

  Fly   474 RPATNGNQRKGCRWAMNPDR----INKMDEEVQKWSRKDPAAI---RGAMVYPQHLESLER 527
             |....:..||..|.::|..    |.....::::.|....|.:   |||.:....|..::|
Mouse   235 -PRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGARLTSTGLTFMDR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 36/91 (40%)
Foxg1NP_001153584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..173 11/66 (17%)
FH 173..261 CDD:214627 36/89 (40%)
Required for interaction with TLE6. /evidence=ECO:0000269|PubMed:16314515 241..336 12/54 (22%)
Interaction with KDM5B. /evidence=ECO:0000250 375..398
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..447
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.