DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxd3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_034555.3 Gene:Foxd3 / 15221 MGIID:1347473 Length:469 Species:Mus musculus


Alignment Length:235 Identity:68/235 - (28%)
Similarity:93/235 - (39%) Gaps:42/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 LTFANSAAYQKLK-QTSLVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIA--SAANSP-- 346
            :|.:.|.:...:. ||.|......|......:.||:.:||: .|..:...|..:.  .|...|  
Mouse     1 MTLSGSGSASDMSGQTVLTAEDVDIDVVGEGDDGLEEKDSD-AGCDSPAGPPDLRLDEADEGPPV 64

  Fly   347 --HHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVN----------IANNNTSGAGSGLV------ 393
              ||......:|..|     :.|:.| ||.:....          :......|||||..      
Mouse    65 SAHHGQSQPQALALP-----TEATGP-GNDTGAPEADGCKGGEDAVTGGGGPGAGSGATGGLTPN 123

  Fly   394 KPLQQKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNS 458
            ||....|          ||.|||..||.:|:..|....|.:|.|..|:...|||:......|:||
Mouse   124 KPKNSLV----------KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNS 178

  Fly   459 VRHNLSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD 498
            :|||||||.||.||  |...||..||..|.::|...:..|
Mouse   179 IRHNLSLNDCFVKI--PREPGNPGKGNYWTLDPQSEDMFD 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/88 (43%)
Foxd3NP_034555.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..127 29/132 (22%)
Forkhead 131..217 CDD:278670 38/88 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.