DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxl1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:292 Identity:74/292 - (25%)
Similarity:121/292 - (41%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 IASAANSPHHQMQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQKVKLP 403
            :|:.|.||...:.|....|.|.:.:.::|.                   ||.|.|:|.|      
Mouse     9 LAALAASPLLYVYSPERPGLPLAFAPAAAL-------------------AGPGRVEPPQ------ 48

  Fly   404 PVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKC 468
                   ||.|||..|||:|::::....:.::.||.|:...||::.:...||:||:|||||||:|
Mouse    49 -------KPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNEC 106

  Fly   469 FEKIERPATNGNQRKGCRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLES-LERGEMK- 531
            |.|:  |...|...||..|.::|..::..:....:..::.|....|:   |:...: :|..|.: 
Mouse   107 FVKV--PREKGRPGKGSYWTLDPRCLDMFENGNYRRRKRKPKPAAGS---PEAKRTRVEPPESEV 166

  Fly   532 ---HGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQI-----INDFD 588
               .||.|....|.::     :.|..:.....|...|:|.....|..|.|.|..:     :....
Mouse   167 GCDVGSPDLATALPTR-----APDRSQSPAVGTARPALLPWPGPEPRDPDADLTVQGAGAVASGQ 226

  Fly   589 AEDERHANGNQANNLPINHPLLGQKSNDFDIE 620
            .:...|..|:.....|...| .|.||..|.|:
Mouse   227 LQRPAHHLGSPLCPAPSGSP-KGSKSKSFSID 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 34/87 (39%)
Foxl1NP_032050.2 FH 49..137 CDD:214627 34/89 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 16/81 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.