DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and Foxi1

DIOPT Version :10

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_076396.3 Gene:Foxi1 / 14233 MGIID:1096329 Length:372 Species:Mus musculus


Alignment Length:223 Identity:56/223 - (25%)
Similarity:97/223 - (43%) Gaps:40/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            :|.||||.|||:|:..:....|.:|:||.::..:||::..:.:||:||:|||||||.||:|:  |
Mouse   117 RPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKV--P 179

  Fly   476 ATNGNQRKGCRWAMNPDRINKMDEEVQKWSRK---DPAAIRGAMVYPQHLESLERGEMKHGSADS 537
            ....:..||..|.::|:.....|....:..||   |.::...::.    .|..|.|.:    |.|
Mouse   180 RDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSSSSTSSLA----SEKTENGLL----ASS 236

  Fly   538 DVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIINDFDAEDERHANGNQANN 602
            ....:.|..::.:|.           |......|............:|:|.:....:.:|..   
Mouse   237 PKPTEPQEVLDTASP-----------DTTTSSPEKRSSPAPSGTPCLNNFLSTMTAYVSGTN--- 287

  Fly   603 LPINHPL------------LGQKSNDFD 618
             ||:..:            :||.|.:|:
Mouse   288 -PISRSVATPGLSSEPIDKMGQNSLNFN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 COG5025 <254..>523 CDD:227358 38/114 (33%)
FH_FOXN1-like 411..491 CDD:410804 33/79 (42%)
Foxi1NP_076396.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
FH_FOXI1 114..213 CDD:410827 37/97 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..271 13/87 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.