Sequence 1: | NP_524302.1 | Gene: | jumu / 41265 | FlyBaseID: | FBgn0015396 | Length: | 719 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076396.3 | Gene: | Foxi1 / 14233 | MGIID: | 1096329 | Length: | 372 | Species: | Mus musculus |
Alignment Length: | 223 | Identity: | 56/223 - (25%) |
---|---|---|---|
Similarity: | 97/223 - (43%) | Gaps: | 40/223 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
Fly 476 ATNGNQRKGCRWAMNPDRINKMDEEVQKWSRK---DPAAIRGAMVYPQHLESLERGEMKHGSADS 537
Fly 538 DVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIINDFDAEDERHANGNQANN 602
Fly 603 LPINHPL------------LGQKSNDFD 618 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
jumu | NP_524302.1 | Forkhead | 411..499 | CDD:278670 | 34/87 (39%) |
Foxi1 | NP_076396.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
FH | 117..205 | CDD:214627 | 35/89 (39%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 202..271 | 13/87 (15%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |