DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment jumu and Foxh1

DIOPT Version :9

Sequence 1:	NP_524302.1	Gene:	jumu / 41265	FlyBaseID:	FBgn0015396	Length:	719	Species:	Drosophila melanogaster
Sequence 2:	NP_032015.1	Gene:	Foxh1 / 14106	MGIID:	1347465	Length:	401	Species:	Mus musculus

Alignment Length:	81	Identity:	32/81 - (39%)
Similarity:	50/81 - (61%)	Gaps:	3/81 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIER- 474
            ||.|:|..:|||.::.:....|.:::|...:...||:|.:...|||:|:|||||.|:||.|:.:
Mouse    64 KPPYTYLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFHKVPKD 128

  Fly   475 PATNGNQRKGCRWAMN 490
            ||.  .|.||..||::
Mouse   129 PAK--PQAKGNFWAVD 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
jumu	NP_524302.1	Forkhead	411..499	CDD:278670	32/81 (40%)
Foxh1	NP_032015.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	32..57
		FH	64..142	CDD:238016	32/79 (41%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	179..251
		SMAD-interaction domain (SID)	307..390
		Fast/FoxH1 motif 1 (FM1)	311..315
		Fast/FoxH1 motif 2 (FM2)	321..327
		SMAD interaction motif (SIM)	363..384
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG2294
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1270467at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.820