DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and LOC1270277

DIOPT Version :10

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_061503012.1 Gene:LOC1270277 / 1270277 VectorBaseID:AGAMI1_001585 Length:560 Species:Anopheles gambiae


Alignment Length:74 Identity:33/74 - (44%)
Similarity:47/74 - (63%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 KPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERP 475
            ||.:||..|||:|:.::....|.:|.||.::..:|||:.....||:||:|||||||.||.|:.|.
Mosquito    69 KPPFSYIALIAMAISSAPNQRLTLSGIYKYIMDNFPYYRENRQGWQNSIRHNLSLNDCFIKVPRE 133

  Fly   476 ATNGNQRKG 484
            ..:|...||
Mosquito   134 KASGTGGKG 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 COG5025 <254..>523 CDD:227358 33/74 (45%)
FH_FOXN1-like 411..491 CDD:410804 33/74 (45%)
LOC1270277XP_061503012.1 None

Return to query results.
Submit another query.