DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and FOXN4

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_011536224.1 Gene:FOXN4 / 121643 HGNCID:21399 Length:518 Species:Homo sapiens


Alignment Length:357 Identity:122/357 - (34%)
Similarity:170/357 - (47%) Gaps:58/357 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 LVKSPGGISPGAGSNMGLKREDSNKRGLQASTTPKSIASAANSPHHQMQSNYSLGSPSSL----- 362
            |:..|.|::|.....:|   ..:..|..|.|..|     ....|...:|....|.||::.     
Human    95 LLHGPAGMAPRGMPGLG---PITGHRDSQMSQFP-----VGGQPSSGLQDPPHLYSPATQPQFPL 151

  Fly   363 -SSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQQ-------KVKLPPVGSPFPKPAYSYSCL 419
             ..:....|:|            ..|...|:..|..|       ..:|.|  ..:|||.||||||
Human   152 PPGAQQCPPVG------------LYGPPFGVRPPYPQPHVAVHSSQELHP--KHYPKPIYSYSCL 202

  Fly   420 IALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIERPATNGNQRKG 484
            ||:|||||:.|||||||||||:.:|||||:.||.||||||||||||||||||:|. ..:|:.|||
Human   203 IAMALKNSKTGSLPVSEIYSFMKEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVEN-KMSGSSRKG 266

  Fly   485 CRWAMNPDRINKMDEEVQKWSRKDPAAIRGAMVYPQHLESL--ERGEM-----KHGSADSDVELD 542
            |.||:|..||:||:||:.||.|||.|||..:|..|:.|:.|  :|.|.     |.|..::.|...
Human   267 CLWALNLARIDKMEEEMHKWKRKDLAAIHRSMANPEELDKLISDRPESCRRPGKPGEPEAPVLTH 331

  Fly   543 SQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIINDFDAEDER---HANGNQANNLP 604
            :.:.......|...:.....:..:.::.............:..|..|..:.   ||..:.:.: |
Human   332 ATTVAVAHGCLAVSQLPPQPLMTLSLQSVPLHHQVQPQAHLAPDSPAPAQTPPLHALPDLSPS-P 395

  Fly   605 INHPLLGQK-------SNDFDIEVGDLYDAID 629
            :.||.:|:.       |.|.:.||    ||:|
Human   396 LPHPAMGRAPVDFINISTDMNTEV----DALD 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 64/87 (74%)
FOXN4XP_011536224.1 Forkhead 194..281 CDD:278670 64/87 (74%)
FAM75 318..>398 CDD:291323 9/80 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 139 1.000 Domainoid score I4800
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007398
OrthoInspector 1 1.000 - - otm41589
orthoMCL 1 0.900 - - OOG6_107576
Panther 1 1.100 - - LDO PTHR13962
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2111
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.