DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxq1a

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:NP_001230273.1 Gene:foxq1a / 100537750 ZFINID:ZDB-GENE-070424-74 Length:312 Species:Danio rerio


Alignment Length:170 Identity:56/170 - (32%)
Similarity:85/170 - (50%) Gaps:33/170 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 MQSNYSLGSPSSLSSSSASSPLGNVSNLVNIANNNT------SGAGSGLVKPLQQKVKL------ 402
            |.|:.:.||.::||....|..|.....:...::.::      |.|...:..|:..:.:|      
Zfish     3 MHSSSATGSYTALSLFELSEALPMKLEVFCGSHYDSKPAELCSDAEGSIPSPVSAEEELGSDGDC 67

  Fly   403 -----PPV----GSPF---PKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGW 455
                 .||    |.|:   |||.|||..|||:|:::|.:|.|.::||..:|.:.||:|..:.:||
Zfish    68 VAHSPAPVADTKGKPYTRRPKPPYSYIALIAMAIRDSNSGRLTLAEINDYLMKKFPFFRGSYTGW 132

  Fly   456 KNSVRHNLSLNKCFEKI----ERPATNGNQRKGCRWAMNP 491
            :||||||||||.||.|:    .||....|.     |.:||
Zfish   133 RNSVRHNLSLNDCFLKVLRDPSRPWGKDNY-----WMLNP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 39/85 (46%)
foxq1aNP_001230273.1 FH 88..177 CDD:214627 39/85 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.