DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxe3

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_002931457.1 Gene:foxe3 / 100495102 XenbaseID:XB-GENE-480592 Length:398 Species:Xenopus tropicalis


Alignment Length:208 Identity:61/208 - (29%)
Similarity:92/208 - (44%) Gaps:44/208 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 ANSPHHQMQ------SNYSLGSPSSL----SSSSASSPLGNVSNLVNIANNNTSGAGSGLVKPLQ 397
            |:|.|...:      |:.|:.||.|:    ......||...|:.|.:  .:|.:..|....:|:|
 Frog    17 ADSQHSPTEAASPIPSSPSMDSPGSVRVKCEPKGTCSPEEGVNGLPD--EHNQASGGRRRKRPIQ 79

  Fly   398 QKVKLPPVGSPFPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHN 462
            :           .||.|||..|||:|:.||....|.:..||.|:.:.||::......|:||:|||
 Frog    80 R-----------GKPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSIRHN 133

  Fly   463 LSLNKCFEKIERPATNGNQRKGCRWAMNPDRINKMD-----EEVQKWSRKDPAAIRGAMVYPQHL 522
            |:||.||.||  |...|:..||..|.::|...:..|     ...:::.|.|      ...||   
 Frog   134 LTLNDCFVKI--PREPGHPGKGNYWTLDPAAEDMFDNGSFLRRRKRFKRTD------LTTYP--- 187

  Fly   523 ESLERGEMKHGSA 535
                 |.|::.||
 Frog   188 -----GYMQNSSA 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 37/92 (40%)
foxe3XP_002931457.1 FH 82..170 CDD:214627 37/89 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.