DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment jumu and foxl3-ot1

DIOPT Version :9

Sequence 1:NP_524302.1 Gene:jumu / 41265 FlyBaseID:FBgn0015396 Length:719 Species:Drosophila melanogaster
Sequence 2:XP_002932017.1 Gene:foxl3-ot1 / 100488925 XenbaseID:XB-GENE-6035521 Length:246 Species:Xenopus tropicalis


Alignment Length:264 Identity:63/264 - (23%)
Similarity:106/264 - (40%) Gaps:69/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 FPKPAYSYSCLIALALKNSRAGSLPVSEIYSFLCQHFPYFENAPSGWKNSVRHNLSLNKCFEKIE 473
            |.:|||||..|||:|::.|....:.:|.||.|:.:.|||:.:....|:||:|||||||.||.|: 
 Frog    30 FNRPAYSYIALIAMAIQQSPDSKVTLSGIYDFIMKKFPYYRSNQRAWQNSIRHNLSLNSCFVKV- 93

  Fly   474 RPATNGNQR-KGCRWAMNPDRINKMD----------------EEVQKWSRKDPAAIRGAMVYPQH 521
             |.|.||:: ||..|:......:.:|                ::.||..:::.|           
 Frog    94 -PRTEGNEKGKGNYWSFASGCESMLDLFENGNYKRRRRRRNMKKCQKDRKQNQA----------- 146

  Fly   522 LESLERGEMKHGSADSDVELDSQSEIEESSDLEEHEFEDTMVDAMLVEEEDEEEDGDDDEQIIND 586
             ::|..||....|:.:.|...::...|.:|...|                               
 Frog   147 -QALHPGEFSTSSSTAHVIYGNEKRTESTSRQME------------------------------- 179

  Fly   587 FDAEDERHANGNQANNLPINHPLLGQKSNDFDIEVGDLYDAIDIEDDKESVRRIISNDQHIIELN 651
               .|..:...|:.:....:   || ||::....:..:..|.|......|...::.|..|::|..
 Frog   180 ---TDSLYPISNRQSQTSSS---LG-KSDEIKFSIDYILSAPDPLPVLRSQHNVLDNKYHMVETQ 237

  Fly   652 PADL 655
            ..:|
 Frog   238 QLNL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
jumuNP_524302.1 Forkhead 411..499 CDD:278670 38/104 (37%)
foxl3-ot1XP_002932017.1 Forkhead 32..118 CDD:365978 37/87 (43%)
COG5025 33..>224 CDD:227358 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.